Protein Info for HGI48_RS10105 in Dickeya dianthicola 67-19

Annotation: HoxN/HupN/NixA family nickel/cobalt transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 343 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 40 to 53 (14 residues), see Phobius details amino acids 79 to 106 (28 residues), see Phobius details amino acids 119 to 143 (25 residues), see Phobius details amino acids 188 to 213 (26 residues), see Phobius details amino acids 220 to 241 (22 residues), see Phobius details amino acids 261 to 287 (27 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details PF03824: NicO" amino acids 41 to 326 (286 residues), 328.9 bits, see alignment E=1.5e-102 TIGR00802: transition metal uptake transporter, Ni2+-Co2+ transporter (NiCoT) family" amino acids 45 to 323 (279 residues), 388.4 bits, see alignment E=1e-120

Best Hits

KEGG orthology group: K07241, high-affinity nickel-transport protein (inferred from 92% identity to ddd:Dda3937_01620)

Predicted SEED Role

"HoxN/HupN/NixA family nickel/cobalt transporter" in subsystem Transport of Nickel and Cobalt

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RD96 at UniProt or InterPro

Protein Sequence (343 amino acids)

>HGI48_RS10105 HoxN/HupN/NixA family nickel/cobalt transporter (Dickeya dianthicola 67-19)
MLSLLFRNNPRAVAIVSCLVVVNVLVWLLAWGIFHDHAALMATSLLAWCYGLRHAVDADH
IAAIDNVTRKMMQEGKTPLAVGAWFSLGHSSIVILASLALAATAAALQDDMAWFHDVGGV
IGTSVSAGFLLLMALVNLVILRGVWGRFQQFKQGSRETLNQADGVPAAGVMGWLFRTTFR
LVNKSWHMYLVGLLFGLGFDTATEIGVLGISAAGASQGMSIWSIMIFPALFTCGMALVDT
LDNVLMVGAYGWAFSKPQRKLYYNLTITATSVVVAMAIGGMEALGLLADKLDLHTGWWRV
VDAFNEQLGNAGFYVVALFVGCWVISWCNYRWKNYDALNSPIA