Protein Info for HGI48_RS10000 in Dickeya dianthicola 67-19

Annotation: multidrug efflux MFS transporter MdtH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 43 to 57 (15 residues), see Phobius details amino acids 89 to 116 (28 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 189 (27 residues), see Phobius details amino acids 210 to 235 (26 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details amino acids 276 to 293 (18 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 337 to 355 (19 residues), see Phobius details amino acids 367 to 387 (21 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 349 (330 residues), 127.2 bits, see alignment E=3.7e-41 amino acids 212 to 391 (180 residues), 33.8 bits, see alignment E=9.4e-13

Best Hits

Swiss-Prot: 82% identical to MDTH_PECAS: Multidrug resistance protein MdtH (mdtH) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K08162, MFS transporter, DHA1 family, multidrug resistance protein (inferred from 97% identity to ddd:Dda3937_01602)

Predicted SEED Role

"MFS superfamily export protein YceL" in subsystem ZZ gjo need homes

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RD78 at UniProt or InterPro

Protein Sequence (401 amino acids)

>HGI48_RS10000 multidrug efflux MFS transporter MdtH (Dickeya dianthicola 67-19)
MSLMTQARSLGKYFLLLDNMLVVLGFFVVFPLISIRFVDQMGWAALTVGIALGLRQLTQQ
GLGIFGGAIADRFGARPMIVAGMLLRASGFVFMALATTPLMLMLSCVLSALGGTLFEPPR
NAIVIKLTRPHERSRFFSLLMMQDNAGAVIGALLGSWLMQYNFSVVCWVGAAVFVLAAAL
NALLLPAYRISTIRTPIREGMMRVMRDRRFVVYVLTLTGYFMLGVQVLLMMPIMVNELAG
TPSAVKWMYAIEAALSLTLLYPIARWSEKRFRLEQRLMFGLFIMTLSLIPMGMVTSLQWL
LGLIGLFYIGSIIAEPARETLGASLANARARGSYMGFSRMGLALGGALGYSGGGWLFDTG
KALGQPALPWCMLGIIGMLTMAALYWQFHLKRIEPAMLNEH