Protein Info for HGI48_RS09955 in Dickeya dianthicola 67-19

Annotation: carbon-nitrogen hydrolase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00795: CN_hydrolase
  • amino acids 6 to 277 (272 residues), 169.2 bits, E=5.6e-54

Best Hits

KEGG orthology group: None (inferred from 92% identity to dze:Dd1591_2288)

Predicted SEED Role

"Plant-induced nitrilase (EC 3.5.5.1), hydrolyses beta-cyano-L-alanine" (EC 3.5.5.1)

MetaCyc Pathways

• indole-3-acetate biosynthesis V (bacteria and fungi) (1/1 steps found)
• indole glucosinolate activation (herbivore attack) (8/13 steps found)
• indole-3-acetate biosynthesis II (4/12 steps found)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Cyanoamino acid metabolism
• Nitrogen metabolism
• Styrene degradation
• Tryptophan metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.5.1

Sequence Analysis Tools

See A0A7L9RD32 at UniProt or InterPro

Protein Sequence (308 amino acids)

>HGI48_RS09955 carbon-nitrogen hydrolase family protein (Dickeya dianthicola 67-19)
MATSVVAALQIGSSPADNAATLEAILAWEGDIARSGAALVVMPEALLGGYPKGETFGTYL
GYRLPQGREAFAQYYHHAIDLDGEECAALAALSARTGATLVVGAIERDGNTLYCTALFFT
PEAGLAGKHRKLMPTGTERLIWGQGDGSTLTVLDSPVGKIGAVICWENHMPLLRMAMYGK
GVQVWCAPTVDERDIWHASMRHIAHEGRCFVISACQVQPSPAALGIEVPGWDPQRPLING
GSLIVDPLGNVLAGPLTGQAGLLTAEIDADLLAGARYDLDVVGHYARPDVFSLTVDERER
KTVRYRGD