Protein Info for HGI48_RS09945 in Dickeya dianthicola 67-19

Annotation: DeoR/GlpR transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF08279: HTH_11" amino acids 6 to 47 (42 residues), 33.6 bits, see alignment 6e-12 PF08220: HTH_DeoR" amino acids 6 to 57 (52 residues), 57.9 bits, see alignment E=1.3e-19 PF00392: GntR" amino acids 7 to 56 (50 residues), 31 bits, see alignment 3.3e-11 PF00455: DeoRC" amino acids 76 to 230 (155 residues), 134.3 bits, see alignment E=7.8e-43

Best Hits

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_00015)

Predicted SEED Role

"FIG000557: hypothetical protein co-occurring with RecR"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RK14 at UniProt or InterPro

Protein Sequence (251 amino acids)

>HGI48_RS09945 DeoR/GlpR transcriptional regulator (Dickeya dianthicola 67-19)
MLTTQRKQRILEQLAAEGQVLAKQLSEAFGVSEDTVRRDLRELASEGRLQRVHGGALPVS
GTVVSFDARSRMAMGAKHQLARAAAALILPGQVVMIDGGTTSGELVKCLPLTLAATVVTH
SPSVAVALVNHPGIEVVLIGGRLYKHSLVAVGAAAVEALATIRADVFFMGVTGVHPQAGF
STGDREEAYIKRALAARAAETVVMATQDKLNVASRYAIGELAMASTLIVESAVPDAVTAP
FAQAGLSLIRA