Protein Info for HGI48_RS09745 in Dickeya dianthicola 67-19

Annotation: histidinol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 PF00815: Histidinol_dh" amino acids 30 to 429 (400 residues), 541.8 bits, see alignment E=6e-167 TIGR00069: histidinol dehydrogenase" amino acids 38 to 428 (391 residues), 528.7 bits, see alignment E=5.4e-163

Best Hits

Swiss-Prot: 85% identical to HISX_PECAS: Histidinol dehydrogenase (hisD) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00013, histidinol dehydrogenase [EC: 1.1.1.23] (inferred from 97% identity to ddd:Dda3937_02973)

MetaCyc: 80% identical to histidinal/histidinol dehydrogenase (Escherichia coli K-12 substr. MG1655)
Histidinol dehydrogenase. [EC: 1.1.1.23]

Predicted SEED Role

"Histidinol dehydrogenase (EC 1.1.1.23)" in subsystem Histidine Biosynthesis (EC 1.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RD19 at UniProt or InterPro

Protein Sequence (436 amino acids)

>HGI48_RS09745 histidinol dehydrogenase (Dickeya dianthicola 67-19)
MSNRFNTLIDWQACTEEEQRQLLTRPAISASERISAIVGEILAKVRDDGDAALREYSARF
DKVQVDSLRVPAAAIDAAAARLGDDIKQAMATAVRNIETFHNAQKLPSISVETQPGVRCQ
QVTRPIASVGLYIPGGSAPLLSTVLMLATPARIAGCQRVTLCSPPPIADEILYAAKLCGV
QDVFQLGGAQAVAAMAFGTGSVPKVDKIFGPGNAYVTEAKRQVSQLLDGAAIDMPAGPSE
VLVIADSGATPDFVASDLLSQAEHGPDSQVILLTPDAGMAQAVIDAVERQLTTLSRADIA
RQALAASRVIVARDLDQCIDISNQYGPEHLIIQTRNAEALVERITSAGSVFLGDWSPESA
GDYASGTNHVLPTYGYTATYSSLGLADFQKRMTVQQLSPQGLLGLASTIEIMAQAEQLTA
HKNAVTLRVNALKEQA