Protein Info for HGI48_RS09390 in Dickeya dianthicola 67-19

Annotation: DUF418 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 383 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 51 to 72 (22 residues), see Phobius details amino acids 79 to 97 (19 residues), see Phobius details amino acids 103 to 120 (18 residues), see Phobius details amino acids 131 to 148 (18 residues), see Phobius details amino acids 192 to 211 (20 residues), see Phobius details amino acids 228 to 249 (22 residues), see Phobius details amino acids 270 to 290 (21 residues), see Phobius details amino acids 302 to 323 (22 residues), see Phobius details amino acids 330 to 351 (22 residues), see Phobius details PF04235: DUF418" amino acids 210 to 368 (159 residues), 139.6 bits, see alignment E=4.8e-45

Best Hits

Swiss-Prot: 57% identical to YEIB_ECOLI: Uncharacterized protein YeiB (yeiB) from Escherichia coli (strain K12)

KEGG orthology group: K07148, uncharacterized protein (inferred from 90% identity to ddd:Dda3937_03496)

Predicted SEED Role

"FIG00924762: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJE7 at UniProt or InterPro

Protein Sequence (383 amino acids)

>HGI48_RS09390 DUF418 family protein (Dickeya dianthicola 67-19)
MLDFARGLAVLGILLMNIVSFGLPHAAYLNPAWQGPPAAADAWTWALMDMVAQGKFLTLF
ALLFGAGLQLLLKRGKRWIHARLFWLMVLGLLHSLFWWDGDILLDYGLIGLVCFGLLQHA
GSTGMLLRTGVVLYLMGLAMLVVLSQVLSPDGGSFWQPGPAEVAYEAGWLTQGGPEAWHN
RLSLLNESLLSLGIQYGWLLAGSMLMGAALMRSGWLRGQFSQRHYRRIALWLLPLALLIN
ALGVMAQWHLQWEYRWCGLLLQIPREVSAPLQAVAYLALCYGFWPALANWRLTRWVVDVG
RMALSSYLLQTLIGTALFNRLGWFMQLDRWQLLLVVPPVWLCNLLAARLWLSVFGQGPVE
SVWRWLTARVAGPVQHNPRTNPD