Protein Info for HGI48_RS09170 in Dickeya dianthicola 67-19

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 566 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 45 to 64 (20 residues), see Phobius details amino acids 75 to 98 (24 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 140 to 160 (21 residues), see Phobius details amino acids 169 to 191 (23 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 29 to 190 (162 residues), 149.4 bits, see alignment E=1.6e-47 PF01590: GAF" amino acids 228 to 346 (119 residues), 25.3 bits, see alignment E=3.8e-09 PF06580: His_kinase" amino acids 359 to 438 (80 residues), 90.1 bits, see alignment E=1.9e-29 PF02518: HATPase_c" amino acids 456 to 550 (95 residues), 36.4 bits, see alignment E=1.3e-12

Best Hits

Swiss-Prot: 78% identical to YPDA_ECOLI: Sensor histidine kinase YpdA (ypdA) from Escherichia coli (strain K12)

KEGG orthology group: K02478, two-component system, LytT family, sensor kinase [EC: 2.7.13.3] (inferred from 98% identity to ddd:Dda3937_03817)

MetaCyc: 78% identical to sensor histidine kinase PyrS (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"putative sensor protein"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RD13 at UniProt or InterPro

Protein Sequence (566 amino acids)

>HGI48_RS09170 sensor histidine kinase (Dickeya dianthicola 67-19)
MRSTFDMLLAVYDRAALMLICLFFLTRTRHFRQLLQQDEHSRFDLAVVTAIFSLFALFST
WSGINVEGSLVNVRVVAVMSGGILFGPWVGITTGIIAGAHRYLIDIHGITSIPCLITSIV
AGFMSAWIHRRIPRDRHWSVGIAGGMLCESLTMLLVVLWARPFSLGLDIVAHIAIPMILG
AVSIGLIVLLVRSVEGEKEAIAARQAKLALDIANKTLPLFRHSNSQSLSTVCDIIRCDID
ADAVAITDISQVLAYVGVGEENYHSGDRDLSPTTQLALKDGKIIIKNNDEAYRTPEIHSM
IVIPLWEKGEVTGTLKIYYRRAHRITWSLKEMAIGLSQIISTQLEVSRAEQLREMANRAE
LRALQSKINPHFLFNALNAISTSIRLNPDTARQLIINLSRYLRYNLERNDEELIDIKSEL
YQIKDYIAIEQARFGDKLTVIYDIDEEVSCHIPSLLIQPLIENAIVHGIRPCKGKGVVTL
SIQEQGERIRVTVRDTGSGISDEVIARVERNELPGNKIGLLNVHHRIKLLYGEGLRIRRL
NPGTEIDFFITRDNLNRSDSMAAFPS