Protein Info for HGI48_RS08545 in Dickeya dianthicola 67-19

Annotation: helix-turn-helix transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 72 PF13560: HTH_31" amino acids 10 to 63 (54 residues), 50.6 bits, see alignment E=3e-17 PF12844: HTH_19" amino acids 12 to 65 (54 residues), 33.1 bits, see alignment E=6.5e-12 PF01381: HTH_3" amino acids 15 to 67 (53 residues), 58 bits, see alignment E=1.2e-19

Best Hits

KEGG orthology group: None (inferred from 99% identity to ddd:Dda3937_01753)

Predicted SEED Role

"FIG00923766: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJD6 at UniProt or InterPro

Protein Sequence (72 amino acids)

>HGI48_RS08545 helix-turn-helix transcriptional regulator (Dickeya dianthicola 67-19)
MKNTKDITAHFGQRVKTLRLQAGLSQEAFADKCGLDRTYISGIERGVRNPTLEVIGVIAD
GLEIQLQSLFDF