Protein Info for HGI48_RS08130 in Dickeya dianthicola 67-19

Annotation: efflux RND transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 392 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF16576: HlyD_D23" amino acids 56 to 285 (230 residues), 64.5 bits, see alignment E=2.3e-21 PF13533: Biotin_lipoyl_2" amino acids 57 to 104 (48 residues), 47 bits, see alignment 4.3e-16 PF13437: HlyD_3" amino acids 213 to 292 (80 residues), 50.8 bits, see alignment E=6e-17 PF00529: CusB_dom_1" amino acids 234 to 341 (108 residues), 33.6 bits, see alignment E=7.4e-12

Best Hits

Swiss-Prot: 46% identical to EMRA_ECOLI: Multidrug export protein EmrA (emrA) from Escherichia coli (strain K12)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 93% identity to ddd:Dda3937_00756)

MetaCyc: 46% identical to multidrug efflux pump membrane fusion protein EmrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RCK5 at UniProt or InterPro

Protein Sequence (392 amino acids)

>HGI48_RS08130 efflux RND transporter periplasmic adaptor subunit (Dickeya dianthicola 67-19)
MDTTSTPSAPRNGRRKRQFAILLLVLLLGAAGSTAYYQLYLRFYETTDNAYVGGNLITLT
PQVGGTVTQVSVDDGDYVEKGQLLVQLSQSDTLIALQQSEAQLASAVRQVRGLYSTVDNY
QAQVASRQVALQQAIGDYHRRKGLATKGAISAEDLAHYQDAVNSARIALDAAEQALRTNQ
ARVDNTVLDDHPDIKNAVADLRSKYLDWARSAIVAPVSGYVARRAVQVGMRVSAGATLMT
IVPLDQVWVDANFKESQMLQMRLGQPVTLTADIYGDKNVYHGTIQSLGIGTGSAFSLLPA
QNASGNWIKIVQRLPVRIALEPEGLKQRPLRIGLSMLASVDLHNTQGELLPGAPVNAPRY
RTDVYDDPLRQADNLVAKILRDNSQPLTSSRG