Protein Info for HGI48_RS08045 in Dickeya dianthicola 67-19

Annotation: deferrochelatase/peroxidase EfeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01412: Tat-translocated enzyme
  • amino acids 24 to 435 (412 residues), 569.2 bits, E=7.8e-175
• TIGR01409: Tat (twin-arginine translocation) pathway signal sequence
  • amino acids 29 to 52 (24 residues), 18.6 bits, see alignment (E = 2.8e-07)
• PF04261: Dyp_perox_N
  • amino acids 76 to 227 (152 residues), 148.8 bits, E=1.2e-47
• TIGR01413: Dyp-type peroxidase family
  • amino acids 76 to 424 (349 residues), 334.2 bits, E=1.4e-103
• PF20628: Dyp_perox_C
  • amino acids 241 to 424 (184 residues), 174.7 bits, E=1.4e-55

Best Hits

Swiss-Prot: 73% identical to EFEB_YERPS: Deferrochelatase/peroxidase EfeB (efeB) from Yersinia pseudotuberculosis serotype I (strain IP32953)

KEGG orthology group: K07223, putative iron-dependent peroxidase (inferred from 94% identity to ddd:Dda3937_00792)

MetaCyc: 74% identical to heme-containing peroxidase/deferrochelatase (Escherichia coli K-12 substr. MG1655)
PROTOHEMEFERROCHELAT-RXN [EC: 4.98.1.1]

Predicted SEED Role

"Ferrous iron transport peroxidase EfeB"

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (10/10 steps found)
• superpathway of heme b biosynthesis from uroporphyrinogen-III (6/6 steps found)
• superpathway of heme b biosynthesis from glycine (7/8 steps found)
• heme b biosynthesis I (aerobic) (4/4 steps found)
• heme b biosynthesis II (oxygen-independent) (4/4 steps found)
• heme b biosynthesis V (aerobic) (4/4 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.98.1.1

Sequence Analysis Tools

See A0A7L9RC87 at UniProt or InterPro

Protein Sequence (437 amino acids)

>HGI48_RS08045 deferrochelatase/peroxidase EfeB (Dickeya dianthicola 67-19)
MSHNTGPRHGPQSSQSSACPAQPDVASPSRRRLLQGLGMMGGALALGADRLAQAQDKPQA
PQDERWEKQPFYGPHQAGIVTPQQAAMMLVAFDVLATSKSELTRLFQLLTQRIAFLTQGG
KVPNADPRLPPLDSGIMGPEIYPDNLTITVSVGASLFDERFGLQALKPLKLQRMTRFPND
SLDASLCHGDLLLQICANTNETVLHALRDIIKQTPDLLSVRWKREGFISAHAARSKGQET
PVNLLGFKDGTANPNTGDSALMDAMLWVGASSGEPAWATDGSYQAARLIRFHVEFWDRTP
LREQQTIFGRDKHSGAPLGMTHEHDEPDYRQDPEGKVIPLDAHIRLANPRTPETRANLML
RRGYSYSLGVSNSGQLDMGLLFVCYQADLEKGFLTVQKRLDGEPLEEYIKPIGGGYFFVL
PGVKRADDWLASGLLMA