Protein Info for HGI48_RS07800 in Dickeya dianthicola 67-19

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 transmembrane" amino acids 33 to 54 (22 residues), see Phobius details amino acids 107 to 130 (24 residues), see Phobius details amino acids 142 to 163 (22 residues), see Phobius details amino acids 169 to 185 (17 residues), see Phobius details amino acids 223 to 251 (29 residues), see Phobius details amino acids 272 to 293 (22 residues), see Phobius details PF12911: OppC_N" amino acids 27 to 74 (48 residues), 34 bits, see alignment 2.1e-12 PF00528: BPD_transp_1" amino acids 121 to 303 (183 residues), 108.3 bits, see alignment E=3.9e-35

Best Hits

Swiss-Prot: 35% identical to DPPC_HAEIN: Dipeptide transport system permease protein DppC (dppC) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 94% identity to ddd:Dda3937_02993)

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RC23 at UniProt or InterPro

Protein Sequence (306 amino acids)

>HGI48_RS07800 ABC transporter permease (Dickeya dianthicola 67-19)
MSPSGRSVHTRSGAPAARSALARTLSLLWHDRLARLGLFTLALIVGLALLAPWISPQNPY
DLTQLMIMDNRLPPGSAGMGGLTYWLGSDDQGRDLLSAMLYGTRTSLTVGVSSALAALAI
GMTAGMLSAWQGGKTDALLMRIVDIQLSFPPLLIALILLAVLGQGVDKIILALVITQWAY
YARTIRASALLESRRNYVDAARGMAFSTPRILFRHMLPNCLPPLIVVATLRIAYAIMLEA
TLSFLGIGLPITEPSLGLLIANGFDYLLSGDYWISLFPGVMLLLLIVAINLIGDALRDAL
NTRQEE