Protein Info for HGI48_RS07610 in Dickeya dianthicola 67-19

Annotation: MBL fold metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 351 PF13483: Lactamase_B_3" amino acids 73 to 280 (208 residues), 51.2 bits, see alignment E=2.2e-17 PF00753: Lactamase_B" amino acids 74 to 133 (60 residues), 28.1 bits, see alignment E=2.8e-10 PF12706: Lactamase_B_2" amino acids 86 to 281 (196 residues), 177.6 bits, see alignment E=3.6e-56

Best Hits

KEGG orthology group: None (inferred from 88% identity to dze:Dd1591_2663)

Predicted SEED Role

"Outer membrane protein romA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RC02 at UniProt or InterPro

Protein Sequence (351 amino acids)

>HGI48_RS07610 MBL fold metallo-hydrolase (Dickeya dianthicola 67-19)
MADPQAKHYSPETGRFFNPQPSTAPRMSLWQSLSLLWRLGFQRKGRVPDQRLPEMSPDLN
AFLAADERAKFIWFGHSTLLLNLDDTRILVDPVFSASVSPFSFMFRRFQPPALAREALPD
IDIILLSHDHYDHLDEQTIRAFRDTATRFIAPLKVGEHLKKWGIAAQRIQELDWYQSHTL
NGITFTATPSHHFSGRSLSGRNTTLWASWVIQGQRERLFFSGDSGYGEHFRHIGERFGPF
SLAFVENGQYNHRWPDSHMHPEQTVQAAQDLRAHLFMPVHWGMFALAFHDWADPVRRSSQ
LARERQLPMIMPMLGEVVTLGTPTATAAWWEKYVDARHTPLIADAAVQDVE