Protein Info for HGI48_RS07555 in Dickeya dianthicola 67-19

Annotation: siderophore biosynthesis protein SbnG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03328: HpcH_HpaI
  • amino acids 26 to 235 (210 residues), 118.8 bits, E=1.1e-38

Best Hits

KEGG orthology group: K02510, 2,4-dihydroxyhept-2-ene-1,7-dioic acid aldolase [EC: 4.1.2.-] (inferred from 94% identity to dze:Dd1591_2673)

Predicted SEED Role

"Achromobactin biosynthesis protein AcsB, HpcH/HpaI aldolase family"

KEGG Metabolic Maps

• Fructose and mannose metabolism
• Lysine degradation
• Naphthalene and anthracene degradation
• Pentose phosphate pathway
• Phenylalanine, tyrosine and tryptophan biosynthesis
• Tyrosine metabolism
• alpha-Linolenic acid metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.-

Sequence Analysis Tools

See A0A7L9RCA6 at UniProt or InterPro

Protein Sequence (258 amino acids)

>HGI48_RS07555 siderophore biosynthesis protein SbnG (Dickeya dianthicola 67-19)
MLRINHLKRKLAAGTSVYGLIASIPSPVSVELIAEAGFDFVIIDSEHVLINPETVENMIR
VAESYALTPLVRVADANPKTMLRLLDGGAQGIVLPMVEQAEQVRAAVRACYYHPQGERSL
NSGRPGAFGKHSLAEYVALANREIMLTAMIESAEGVRQAEAIAAVAGLDMILEGAADLSQ
SLGIPWQTAAAPVQAALAEVRRAADAHGVTYCAIPRQHDDHARWREQGVRAFVLGDERGI
AFRALQARLAATISAEGM