Protein Info for HGI48_RS07400 in Dickeya dianthicola 67-19
Annotation: D-cysteine desulfhydrase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to CUYA_ROSNI: L-cysteate sulfo-lyase (cuyA) from Roseovarius nubinhibens (strain ATCC BAA-591 / DSM 15170 / ISM)
KEGG orthology group: K05396, D-cysteine desulfhydrase [EC: 4.4.1.15] (inferred from 95% identity to ddd:Dda3937_02691)MetaCyc: 62% identical to L-cysteate sulfo-lyase (Roseovarius nubinhibens ISM)
L-cysteate sulfo-lyase. [EC: 4.4.1.25]
Predicted SEED Role
"pyridoxal phosphate-dependent deaminase, putative"
MetaCyc Pathways
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
- D-serine degradation (3/3 steps found)
- L-serine degradation (3/3 steps found)
- L-tryptophan degradation II (via pyruvate) (3/3 steps found)
- L-methionine biosynthesis II (5/6 steps found)
- L-cysteine degradation II (2/3 steps found)
- sulfolactate degradation III (2/3 steps found)
- glycine betaine degradation III (4/7 steps found)
- superpathway of sulfolactate degradation (3/6 steps found)
- felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
- L-mimosine degradation (4/8 steps found)
- glycine betaine degradation I (4/8 steps found)
- glutathione-mediated detoxification I (3/8 steps found)
- purine nucleobases degradation II (anaerobic) (13/24 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.4.1.15 or 4.4.1.25
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A7L9RBZ4 at UniProt or InterPro
Protein Sequence (337 amino acids)
>HGI48_RS07400 D-cysteine desulfhydrase (Dickeya dianthicola 67-19) MHLARFPRLSLGHFPTPLEPLPRLSAYLGGPTIYIKRDDATGLATGGNKTRKLEFLLAEA LQQDADVIITQGATQSNHVRQTIAGAARLGLKTQVLLEKRVDDYGVDYQRSGNVLLDKLL GGDIVGHLPAGTDMQQAMEALAATLREQGHRPYVIPGGGSSPTGALGYVACAEELLYQSS QQRLRIDHIVHATGSTGTQAGLVTGLVASHSGIPVLGISVRAPQAKQEENVWQLAQRTWQ KLGLAGEVPREAVQVNSDYVGQGYGIPTAGTLEALKLAAQLEGILLDPVYSGKALAGLID LVRKGQFGKNDNVLFIHTGGAAGLFGYRQLFEQQEGW