Protein Info for HGI48_RS07340 in Dickeya dianthicola 67-19

Annotation: respiratory chain complex I subunit 1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 70 to 92 (23 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 138 to 161 (24 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 259 to 281 (23 residues), see Phobius details amino acids 292 to 313 (22 residues), see Phobius details PF00146: NADHdh" amino acids 16 to 311 (296 residues), 190.6 bits, see alignment E=2e-60

Best Hits

Swiss-Prot: 66% identical to HYFC_ECOLI: Hydrogenase-4 component C (hyfC) from Escherichia coli (strain K12)

KEGG orthology group: K12138, hydrogenase-4 component C [EC: 1.-.-.-] (inferred from 97% identity to ddd:Dda3937_00729)

Predicted SEED Role

"Hydrogenase-4 component C"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RBY3 at UniProt or InterPro

Protein Sequence (315 amino acids)

>HGI48_RS07340 respiratory chain complex I subunit 1 family protein (Dickeya dianthicola 67-19)
MTYVSLVFPLLGALLQAVLLMAAAPLLSGLSRVIRAKMHSRQGPGVLQDYRDLVKLLRRQ
EVAPEHSGGVFRLMPFILLGTMLLVAMTLPAVTDGSPFGAAGDVITLLYLFTVFRFFFSL
SGLDSGSTFAGIGASRELTLGILVEPILMLSLLVVALVAGSTNIGNISVKLASGQWVSPT
ATALALLACAFATFIEMGKIPFDVAEAEQELQEGPLTEYAGAGLALVKWGISLKQVVVAT
LFLSIFVPFGKAETLTAASLLWGALALIIKLVVVFVIAAVIENSLARGRFLLTGRVTWLG
FGVAALAFVFYLTGL