Protein Info for HGI48_RS07150 in Dickeya dianthicola 67-19

Annotation: AAA family ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 608 PF13514: AAA_27" amino acids 4 to 46 (43 residues), 22.7 bits, see alignment 2e-08 PF13175: AAA_15" amino acids 4 to 60 (57 residues), 42 bits, see alignment 3e-14 amino acids 151 to 356 (206 residues), 70.2 bits, see alignment E=7.9e-23 PF13476: AAA_23" amino acids 6 to 210 (205 residues), 33.8 bits, see alignment E=1.6e-11 PF13304: AAA_21" amino acids 172 to 357 (186 residues), 47.3 bits, see alignment E=8.6e-16 PF20469: OLD-like_TOPRIM" amino acids 411 to 478 (68 residues), 38.7 bits, see alignment E=3.6e-13

Best Hits

KEGG orthology group: None (inferred from 67% identity to psm:PSM_A2054)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJB1 at UniProt or InterPro

Protein Sequence (608 amino acids)

>HGI48_RS07150 AAA family ATPase (Dickeya dianthicola 67-19)
MPSIKKLKIKNFGCIGAQPVELDIDNIVVLVGPNNAGKSTILRAYEVVTDCLKLEQDDFH
NKQVSVDNYPEIEVHSIATEENKPGNEWCLNQDNGTYLVKEQWRWTGTNREPDRVGFNVV
LNRWAQEDDPERMPWGVNNVAKARRPKPHRVNTFDDPEVQSKAITSLLKNLLEDSIKNIK
ENETDEKTKYELLVESLKELRNTSKITQRENIESLEGNANGIISKIFPSHELKISAPESS
APIKIDLLGNEFSIEMGPIGGLTFPLEKQGSGSRRTALWTILKLLADKGMQAKVAGPNAK
SHHEAVGPNTAHVLLLDEPEISLHPSATEIARDVLYSLPENVNWQIMVTTHSPSFIDLTK
DHTTIIRVDKNIDNNIEATTLFKPESVRLDDDDKENLKLINLFDSHISEAFFGGNTLVVE
GDTEYSAFNHIKNIEMSKGNNYYHDLNIIRARGKVTVSSMMKVLNHFGKKFYVLHDTDVP
TVESKRKNNQLSVDGAIVYDKFKIKNPAWTNNQKILDQMTERSRVVASVINFEDAYFDET
IGSDKPENCINHIKNDPGMYSKIKQLLDGILEIGEVMLPEGALAWSDISQLDDAVKARLC
SVKINICE