Protein Info for HGI48_RS06650 in Dickeya dianthicola 67-19

Annotation: multidrug efflux pump-associated protein, AcrZ family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 49 transmembrane" amino acids 7 to 29 (23 residues), see Phobius details PF10766: AcrZ" amino acids 1 to 46 (46 residues), 99.8 bits, see alignment E=2.5e-33

Best Hits

Swiss-Prot: 72% identical to ACRZ_ECO57: Multidrug efflux pump accessory protein AcrZ (acrZ) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_04001)

Predicted SEED Role

"FIG00614259: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4C637 at UniProt or InterPro

Protein Sequence (49 amino acids)

>HGI48_RS06650 multidrug efflux pump-associated protein, AcrZ family (Dickeya dianthicola 67-19)
MFELLKSLLFAVCMVPVMMALILGAIYGLGEVFNLFSAIGHRESAAARK