Protein Info for HGI48_RS06405 in Dickeya dianthicola 67-19

Annotation: EamA family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 142 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 23 to 23 (1 residues), see Phobius details amino acids 36 to 56 (21 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 95 to 117 (23 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details PF00892: EamA" amino acids 3 to 140 (138 residues), 74.5 bits, see alignment E=4.7e-25

Best Hits

KEGG orthology group: K08978, putative membrane protein (inferred from 98% identity to ddd:Dda3937_01554)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RBD1 at UniProt or InterPro

Protein Sequence (142 amino acids)

>HGI48_RS06405 EamA family transporter (Dickeya dianthicola 67-19)
MSSWLLYALLSALCAALVALFGKIGLQQLDANTATAVRAVIMALFLVGVVVAQGKTSLFG
TVLANHKAMVFIVLSGVAGALSWLFYFMALKSGTVAQVAPIDKLSVVFAVILAALLLGEK
VSLLAGFGVALISAGALLVALG