Protein Info for HGI48_RS06130 in Dickeya dianthicola 67-19

Annotation: tRNA(Met) cytidine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08351: TmcA_N
  • amino acids 62 to 146 (85 residues), 29.1 bits, E=3.1e-10
• PF05127: Helicase_RecD
  • amino acids 195 to 341 (147 residues), 130.7 bits, E=2e-41
• PF13718: GNAT_acetyltr_2
  • amino acids 376 to 483 (108 residues), 31 bits, E=5.9e-11
  • amino acids 485 to 540 (56 residues), 27.7 bits, 6e-10
• PF13673: Acetyltransf_10
  • amino acids 459 to 518 (60 residues), 26.1 bits, 2.6e-09
• PF00583: Acetyltransf_1
  • amino acids 462 to 516 (55 residues), 26.2 bits, 3e-09
• PF13508: Acetyltransf_7
  • amino acids 462 to 517 (56 residues), 28.5 bits, 5.7e-10
• PF17176: tRNA_bind_3
  • amino acids 544 to 661 (118 residues), 138.5 bits, E=4.8e-44

Best Hits

Swiss-Prot: 56% identical to TMCA_YERPD: tRNA(Met) cytidine acetyltransferase TmcA (tmcA) from Yersinia pestis (strain D106004)

KEGG orthology group: K06957, tRNA(Met) cytidine acetyltransferase [EC: 2.3.1.-] (inferred from 91% identity to ddd:Dda3937_02503)

Predicted SEED Role

"Predicted P-loop ATPase fused to an acetyltransferase COG1444"

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Alkaloid biosynthesis I
• Alkaloid biosynthesis II
• Anthocyanin biosynthesis
• Benzoate degradation via CoA ligation
• Biosynthesis of terpenoids and steroids
• Biosynthesis of type II polyketide backbone
• Biosynthesis of unsaturated fatty acids
• Butanoate metabolism
• Carotenoid biosynthesis - General
• Diterpenoid biosynthesis
• Ether lipid metabolism
• Ethylbenzene degradation
• Fatty acid biosynthesis
• Glycerophospholipid metabolism
• Glycosphingolipid biosynthesis - ganglio series
• Histidine metabolism
• Limonene and pinene degradation
• Lipopolysaccharide biosynthesis
• Lysine degradation
• Phenylalanine metabolism
• Tyrosine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

See A0A7L9RB99 at UniProt or InterPro

Protein Sequence (672 amino acids)

>HGI48_RS06130 tRNA(Met) cytidine acetyltransferase (Dickeya dianthicola 67-19)
MESFVVSQQYQQRYGIRRLLVLSGQSDWCCAQAQRLSASLPGDWLWVSASAPQGVTAIPP
RNVLGVLGREFLHAVFDARDGLDAQALAMLVGALRSGSWLLLLAPEWDRWPDCPDADSLR
WSEQPEPIATPRFIRHVQHQLLTDDEVVLWRQLDAEPVIELPHRRSDWLPATGEATSCQQ
AILRQLQHTSCAVSVITAPRGRGKSTLAGMLARQCQGVCWVSAPSRAAGEILLRQAGDAA
AFWAPDALLALCRQHGAPPVEWLLIDEAAAIPAPVLQALLPFFRRVVMTTTVQGYEGTGR
GFLLKFCASLPDWQAIELTVPLRWAEQDPLESIIDRVMLFDAEKQVPERLPGSPAIRLER
RDDWLSQPERLAGCYGLLCSAHYRTSPLDLRRLLDAPGMHIASACVEEQVGGVIWLVDEG
GLPQTLAQDIWAGRRRPRGNLVAQSLAAHGNQWQAPVLRSRRISRIAVLAAQRGQGIGQA
LVQEQQQRAQQEQLDFLSVSFGFQPALWRFWQRCGFQLARIGSHIDASSGCYSAMALLPL
SEAGNALAASAHHELLRDWFWLRRDIPVALNLPLMEDQTLTAEDWRNLVGFAMAHRPPEA
CQGALSRLMMRTPMALIGLRLWLEQGRSVAECVHLLQLAGRKALVQRWRAETVQALRQLD
ETVWKHWHDIVL