Protein Info for HGI48_RS05965 in Dickeya dianthicola 67-19
Annotation: 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 67% identical to MENH_PECAS: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (menH) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)
KEGG orthology group: K08680, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC: 4.2.99.20] (inferred from 95% identity to ddd:Dda3937_01782)MetaCyc: 51% identical to 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (Escherichia coli K-12 substr. MG1655)
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. [EC: 4.2.99.20]
Predicted SEED Role
"2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.2.99.20)
MetaCyc Pathways
- superpathway of chorismate metabolism (54/59 steps found)
- superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
- superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
- 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
- superpathway of menaquinol-10 biosynthesis (9/10 steps found)
- superpathway of menaquinol-11 biosynthesis (9/10 steps found)
- superpathway of menaquinol-12 biosynthesis (9/10 steps found)
- superpathway of menaquinol-13 biosynthesis (9/10 steps found)
- superpathway of menaquinol-6 biosynthesis (9/10 steps found)
- superpathway of menaquinol-7 biosynthesis (9/10 steps found)
- superpathway of menaquinol-9 biosynthesis (9/10 steps found)
- superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
- superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
- superpathway of phylloquinol biosynthesis (8/15 steps found)
KEGG Metabolic Maps
Isozymes
No predicted isozymesUse Curated BLAST to search for 4.2.99.20
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A7L9RJS2 at UniProt or InterPro
Protein Sequence (263 amino acids)
>HGI48_RS05965 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase (Dickeya dianthicola 67-19) MQCRRVGQPQPGQPWLVMLHGLLGSGEDWQPVLPYLADWPLLLVDLPGHGASRSLSAVDF ADVSRQLTALLAQQPVTDYWLLGYSLGGRIAMYHACQGDAAGLRGLLVEGGHPGLASAGD RDARRRHDADWARRFRHEPLDSVLPDWYQQPVFARLSPAQRDRLVALRRGNHGPAVADML EATSLSRQPCLVDALQQLRVPFGYLCGSQDTKFQALAAQHRLPLLSVDRAGHNAHQANPS AYAERIRQFISHPERKIQYALSQ