Protein Info for HGI48_RS05965 in Dickeya dianthicola 67-19

Annotation: 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03695: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase
  • amino acids 13 to 250 (238 residues), 264.9 bits, E=3.4e-83
• PF00561: Abhydrolase_1
  • amino acids 14 to 211 (198 residues), 62.9 bits, E=5.7e-21
• PF12697: Abhydrolase_6
  • amino acids 16 to 244 (229 residues), 66.8 bits, E=7e-22
• PF00975: Thioesterase
  • amino acids 16 to 102 (87 residues), 28.5 bits, E=2.6e-10

Best Hits

Swiss-Prot: 67% identical to MENH_PECAS: 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (menH) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K08680, 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase [EC: 4.2.99.20] (inferred from 95% identity to ddd:Dda3937_01782)

MetaCyc: 51% identical to 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (Escherichia coli K-12 substr. MG1655)
2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase. [EC: 4.2.99.20]

Predicted SEED Role

"2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylate synthase (EC 4.2.99.20)" in subsystem Menaquinone and Phylloquinone Biosynthesis (EC 4.2.99.20)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of menaquinol-8 biosynthesis I (10/10 steps found)
• superpathway of demethylmenaquinol-8 biosynthesis I (9/9 steps found)
• 2-carboxy-1,4-naphthoquinol biosynthesis (7/7 steps found)
• superpathway of menaquinol-10 biosynthesis (9/10 steps found)
• superpathway of menaquinol-11 biosynthesis (9/10 steps found)
• superpathway of menaquinol-12 biosynthesis (9/10 steps found)
• superpathway of menaquinol-13 biosynthesis (9/10 steps found)
• superpathway of menaquinol-6 biosynthesis (9/10 steps found)
• superpathway of menaquinol-7 biosynthesis (9/10 steps found)
• superpathway of menaquinol-9 biosynthesis (9/10 steps found)
• superpathway of demethylmenaquinol-6 biosynthesis I (8/9 steps found)
• superpathway of demethylmenaquinol-9 biosynthesis (8/9 steps found)
• superpathway of phylloquinol biosynthesis (8/15 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.99.20

Sequence Analysis Tools

See A0A7L9RJS2 at UniProt or InterPro

Protein Sequence (263 amino acids)

>HGI48_RS05965 2-succinyl-6-hydroxy-2, 4-cyclohexadiene-1-carboxylate synthase (Dickeya dianthicola 67-19)
MQCRRVGQPQPGQPWLVMLHGLLGSGEDWQPVLPYLADWPLLLVDLPGHGASRSLSAVDF
ADVSRQLTALLAQQPVTDYWLLGYSLGGRIAMYHACQGDAAGLRGLLVEGGHPGLASAGD
RDARRRHDADWARRFRHEPLDSVLPDWYQQPVFARLSPAQRDRLVALRRGNHGPAVADML
EATSLSRQPCLVDALQQLRVPFGYLCGSQDTKFQALAAQHRLPLLSVDRAGHNAHQANPS
AYAERIRQFISHPERKIQYALSQ