Protein Info for HGI48_RS05635 in Dickeya dianthicola 67-19

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 14 to 36 (23 residues), see Phobius details amino acids 48 to 68 (21 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 104 to 124 (21 residues), see Phobius details amino acids 136 to 158 (23 residues), see Phobius details amino acids 166 to 186 (21 residues), see Phobius details amino acids 217 to 237 (21 residues), see Phobius details amino acids 250 to 272 (23 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details amino acids 304 to 327 (24 residues), see Phobius details amino acids 340 to 362 (23 residues), see Phobius details amino acids 368 to 389 (22 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 355 (338 residues), 147.8 bits, see alignment E=4.1e-47 amino acids 279 to 394 (116 residues), 37.8 bits, see alignment E=1.1e-13 PF00083: Sugar_tr" amino acids 46 to 189 (144 residues), 34.2 bits, see alignment E=1.4e-12

Best Hits

Swiss-Prot: 70% identical to YAJR_ECOLI: Inner membrane transport protein YajR (yajR) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_04490)

Predicted SEED Role

"Putative transport protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RAZ2 at UniProt or InterPro

Protein Sequence (454 amino acids)

>HGI48_RS05635 MFS transporter (Dickeya dianthicola 67-19)
MSDNRMTPVEQRATWGLGLVFSLRMLGMFMVLPVLTTYGMALQGASESLIGVAIGIYGLM
QALFQIPFGLMSDRIGRKPLIVGGLLIFVLGSVIAALSNSIWGIILGRALQGSGAISAAV
MALLSDLTREQNRTKAMAFIGVSFGITFAIAMVVGPIVTHALGLNALFWGIALLALLAIV
ITLTVIPSSSSHVLNRESAIVRGGVSKVLANGRLLKLNFSIMSLHILLMSSFVALPRVME
QAGLAPQHHWKVYLVTMLASFAAVVPFVIYAEVKRRMKQVFIACVMILIAAELVLLLAGN
HALWQIFIGIQLFFLGFNVMEALLPSLISKESPAGYKGTAMGVYSTTQFIGVAIGGSLGG
ALYDLHGASLVFGAGALLGLAWLLVSFTMQEPPYLSSLRITLPDEALRDNALSDKLQRHP
GVADVVIVPDESSAYVKIDRKKTSRQQLEQLVSQ