Protein Info for HGI48_RS05540 in Dickeya dianthicola 67-19

Annotation: protein translocase subunit SecD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 615 transmembrane" amino acids 7 to 26 (20 residues), see Phobius details amino acids 453 to 471 (19 residues), see Phobius details amino acids 479 to 499 (21 residues), see Phobius details amino acids 505 to 524 (20 residues), see Phobius details amino acids 548 to 571 (24 residues), see Phobius details amino acids 578 to 605 (28 residues), see Phobius details PF13721: SecD-TM1" amino acids 2 to 103 (102 residues), 127.1 bits, see alignment E=8.7e-41 PF07549: Sec_GG" amino acids 120 to 140 (21 residues), 25.3 bits, see alignment (E = 2e-09) TIGR01129: protein-export membrane protein SecD" amino acids 123 to 601 (479 residues), 484.7 bits, see alignment E=2.5e-149 PF21760: SecD_1st" amino acids 227 to 285 (59 residues), 102.3 bits, see alignment 1.9e-33 TIGR00916: protein-export membrane protein, SecD/SecF family" amino acids 345 to 594 (250 residues), 278.2 bits, see alignment E=5.3e-87 PF02355: SecD_SecF" amino acids 433 to 601 (169 residues), 55.1 bits, see alignment E=1.7e-18 PF03176: MMPL" amino acids 487 to 595 (109 residues), 34 bits, see alignment E=4e-12

Best Hits

Swiss-Prot: 85% identical to SECD_ECOLI: Protein translocase subunit SecD (secD) from Escherichia coli (strain K12)

KEGG orthology group: K03072, preprotein translocase subunit SecD (inferred from 97% identity to ddd:Dda3937_01950)

MetaCyc: 85% identical to Sec translocon accessory complex subunit SecD (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Protein-export membrane protein SecD (TC 3.A.5.1.1)" (TC 3.A.5.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XUM8 at UniProt or InterPro

Protein Sequence (615 amino acids)

>HGI48_RS05540 protein translocase subunit SecD (Dickeya dianthicola 67-19)
MLNRYPLWKYLMLIVTIVVGLLYALPNLYGEDPAIQVTGARGTAASESTLVQIQNVLKEQ
NIASKSIALENGAILARFSTSDVQLRAREVLLNALGEKFVVALNLAPATPTWLRMLGAEP
MKLGLDLRGGVHFLMEVDMDTALGKLQEQTMDSLRSDLREKGIQYASVRKSDNYGVDILF
RDGQLRDDAVNYLAPRHRDLVLNSSGSDTLRAVMSDARLGEAREYAVQQNINILRNRVNQ
LGVAEPLVQRQGADRIVVELPGIQDTARAKEILGATATLEFRLVNSNVDPVALTNGRVPG
DTEVMNMRDGGPVALYKRVILTGDHITDSTSGNDEYNRPQVNISLDSAGGNMMSNFTKDN
IGKPMATLFVEYKDSGKKDANGRAVLEKQEEVINVATIQSRLGNSFRITGINNPNEARQL
SLLLRAGALIAPIQIVEERTIGPTLGMQNITQGLEACLAGLAVSILFMIFFYKKFGMIAT
SALLLNLVLVVGIMSLLPGATLTMPGIAGIVLTLAVAVDANVLINERIKEELSNGRTVQQ
AIDEGYRGAFSSIFDANVTTLIKVLILYAIGTGSIKGFAITTGIGVATSMFTAIVGTRAI
VNLLYGGKRIKKLSI