Protein Info for HGI48_RS05490 in Dickeya dianthicola 67-19

Annotation: phosphate regulon sensor histidine kinase PhoR

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 transmembrane" amino acids 12 to 47 (36 residues), see Phobius details PF11808: PhoR" amino acids 6 to 91 (86 residues), 91.7 bits, see alignment E=9.2e-30 TIGR02966: phosphate regulon sensor kinase PhoR" amino acids 96 to 420 (325 residues), 449.7 bits, see alignment E=5.9e-139 TIGR00229: PAS domain S-box protein" amino acids 98 to 211 (114 residues), 24 bits, see alignment E=3.6e-09 PF00989: PAS" amino acids 99 to 194 (96 residues), 39.3 bits, see alignment E=1.8e-13 PF00512: HisKA" amino acids 203 to 268 (66 residues), 76.1 bits, see alignment E=5.5e-25 PF02518: HATPase_c" amino acids 313 to 423 (111 residues), 93.3 bits, see alignment E=4.1e-30 PF13581: HATPase_c_2" amino acids 316 to 401 (86 residues), 27.6 bits, see alignment E=7.3e-10

Best Hits

Swiss-Prot: 73% identical to PHOR_KLEPN: Phosphate regulon sensor protein PhoR (phoR) from Klebsiella pneumoniae

KEGG orthology group: K07636, two-component system, OmpR family, phosphate regulon sensor histidine kinase PhoR [EC: 2.7.13.3] (inferred from 99% identity to dze:Dd1591_3105)

MetaCyc: 73% identical to sensor histidine kinase PhoR (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Phosphate regulon sensor protein PhoR (SphS) (EC 2.7.13.3)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (EC 2.7.13.3)

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RAY4 at UniProt or InterPro

Protein Sequence (440 amino acids)

>HGI48_RS05490 phosphate regulon sensor histidine kinase PhoR (Dickeya dianthicola 67-19)
MLERLSWKKLALELAFFCLPGLLLGLIIGYLPWFLLASVLAALCWNFYNQLRLSYWLWVD
RSMTPPPGRWSWEPLFYGLYQMQLRNRRRRRELALLIKRFRSGAESLPDAVVITTEEGGI
IWCNRLAQHLLSFRWPEDNGQNILNLLRYPEFTQYMQQQDFSRPLTLTLKNAHHVEFRVM
PYSEGQLLMVARDVTQMHQLEGARRNFFANVSHELRTPLTVLQGYLEMMSDESLDGALQS
KALHTMQEQTRRMDGLVRQLLTLSRIEAAAAIDLNEKVDIPLMLRVLKREADTLSQGRHE
IVFRVNEQLQVFGNEEQLRSAVSNLVYNAVNHTPQGTRIEVCWQQTPQGAQFQVSDNGLG
IAAEHLPRLTERFYRVDKARSRQTGGSGLGLAIVKHALSHHDSRLEILSEEGAGSRFMFT
LPNRLIVRSVLSQNAANPQL