Protein Info for HGI48_RS05110 in Dickeya dianthicola 67-19

Annotation: type I methionyl aminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00500: methionine aminopeptidase, type I
  • amino acids 3 to 250 (248 residues), 357.5 bits, E=1.9e-111
• PF00557: Peptidase_M24
  • amino acids 12 to 242 (231 residues), 173 bits, E=3.7e-55

Best Hits

Swiss-Prot: 86% identical to MAP1_SALTY: Methionine aminopeptidase (map) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01265, methionyl aminopeptidase [EC: 3.4.11.18] (inferred from 96% identity to ddd:Dda3937_00878)

MetaCyc: 83% identical to methionine aminopeptidase (Escherichia coli K-12 substr. MG1655)
Methionyl aminopeptidase. [EC: 3.4.11.18]

Predicted SEED Role

"Methionine aminopeptidase (EC 3.4.11.18)" (EC 3.4.11.18)

MetaCyc Pathways

• Arg/N-end rule pathway (eukaryotic) (4/14 steps found)
• Ac/N-end rule pathway (6/21 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.11.18

Sequence Analysis Tools

See A0A7L9RAQ7 at UniProt or InterPro

Protein Sequence (264 amino acids)

>HGI48_RS05110 type I methionyl aminopeptidase (Dickeya dianthicola 67-19)
MAISIKTSEDIEKMRVAGRLAAEVLEIIEPYVVPGVSTGELDRICHDHITNKQHAISACL
GYHGFPKSVCISVNEVVCHGIPSDDKILKDGDIVNIDVTVIKDDFHGDTSKMFIVGKPTI
QGERLCKVTQESLYLALRMIKPGIRLRMLGREIQKYVEAQDFSVVREYCGHGIGRGFHEE
PQVLHYDADDGGVVLQPGMAFTVEPMVNAGDYRIRTMKDGWTVKTKDRSLSAQYEHTIVV
TENGCEIMTLRKDDTLPNLITHQE