Protein Info for HGI48_RS04965 in Dickeya dianthicola 67-19
Annotation: prolipoprotein diacylglyceryl transferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 86% identical to LGT_PECCP: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)
KEGG orthology group: K13292, phosphatidylglycerol:prolipoprotein diacylglycerol transferase [EC: 2.-.-.-] (inferred from 97% identity to ddd:Dda3937_00850)MetaCyc: 79% identical to phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (Escherichia coli K-12 substr. MG1655)
RXN0-20 [EC: 2.5.1.145]
Predicted SEED Role
"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)
MetaCyc Pathways
- lipoprotein posttranslational modification (Gram-negative bacteria) (6/7 steps found)
KEGG Metabolic Maps
- Glycosphingolipid biosynthesis - ganglio series
- Glycosphingolipid biosynthesis - globo series
- Glycosphingolipid biosynthesis - lacto and neolacto series
- Lipopolysaccharide biosynthesis
- Puromycin biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.-.-.-
Use Curated BLAST to search for 2.-.-.- or 2.4.99.- or 2.5.1.145
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A7L9RAN8 at UniProt or InterPro
Protein Sequence (287 amino acids)
>HGI48_RS04965 prolipoprotein diacylglyceryl transferase (Dickeya dianthicola 67-19) MTTSYLVFPQFDPVIFSLGPVSLHWYGLMYLVGFVFAMWLAVRRANKPGSGWHKEEVENL LYFGFLGVFVGGRLGYVLFYAFPAFLDNPLYLFRVWDGGMSFHGGLLGVITVMLWFAHRT KRHFFQVSDLIAPLIPFGLGAGRLGNFINGELWGRVTTDAPWAMLFPSSRGEDMALAAGN PQWQAIFNQYGVLPRHPSQLYELVLEGVVLFIILNVFIRKARPLGSVSGLFLIGYGSFRI IVEFFRQPDAQLGLFSGISMGQILSVPMVLAGILMMVWAYRRQSARQ