Protein Info for HGI48_RS04660 in Dickeya dianthicola 67-19

Annotation: conjugal transfer protein TraF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13729: TraF_2" amino acids 50 to 332 (283 residues), 255.4 bits, see alignment E=2.8e-80

Best Hits

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_01475)

Predicted SEED Role

"IncI1 plasmid conjugative transfer protein TraF" in subsystem Type 4 conjugative transfer system, IncI1 type

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RAQ1 at UniProt or InterPro

Protein Sequence (415 amino acids)

>HGI48_RS04660 conjugal transfer protein TraF (Dickeya dianthicola 67-19)
MHKKLFVRAITVAGLFSPAMTFAAGIGSDARNDAMGGTGVASSHYGSAALTNPALLTKAQ
ASDNVSLILPSIGVMVSDPDKVEDKFDRIKTSWDSIKDVLNSSSGITNPLLRRLALQQGI
SSFQSLRGELNSINNARAYGDAAAATVVAVPNDTLPFAVVVKSWGVANARAVVTDRDLAY
LDSVAAGAAIPTAADLNNFTSRAEGAGALVTEYGVAMAKAFSIAGQPVSVGITPKLQRID
TYNYIASINNYSTSDFRNSEFKKSSSGANLDLGFSTDLTSRWSAGLVAQNLIGRRIDTKE
VQGIQRTFHLRPQVTAGTAWSTETLTLATDIDLTPASGFDSEKKNQYAGVGAEYRVLSWA
QLRVGYRANMRDSDKNLVTAGFGLSPFGVHLDLTGMVGTESKHTYGAAAKLSFTF