Protein Info for HGI48_RS04020 in Dickeya dianthicola 67-19

Annotation: S26 family signal peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 signal peptide" amino acids 1 to 38 (38 residues), see Phobius details PF10502: Peptidase_S26" amino acids 20 to 190 (171 residues), 88.2 bits, see alignment E=3.1e-29

Best Hits

Swiss-Prot: 30% identical to TRAF_SINFN: Probable conjugal transfer protein TraF (traF) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: None (inferred from 80% identity to aav:Aave_0690)

Predicted SEED Role

"Type IV secretory pathway, protease TraF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RA79 at UniProt or InterPro

Protein Sequence (195 amino acids)

>HGI48_RS04020 S26 family signal peptidase (Dickeya dianthicola 67-19)
MTMIPTIGPAPRSRSRLRARLVLASLSVFGFAALAWASFGTQPPRVIYNPSDSVAVGWYR
VEPFDPHTASLPRPLSVGSIVLVPLPAEAAALAAQRGYLPVRVPLLKRVGAMAPQEVCIS
GGIVYIDGVPAAAALPTDRLGRSLPSLQLCRHLEPGELFLLSVTNPASFDSRYFGPVSAS
AVIGVARPIWLETRP