Protein Info for HGI48_RS04000 in Dickeya dianthicola 67-19

Annotation: DoxX family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 136 transmembrane" amino acids 21 to 44 (24 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 108 to 131 (24 residues), see Phobius details PF13564: DoxX_2" amino acids 22 to 115 (94 residues), 44.9 bits, see alignment E=1.1e-15 PF07681: DoxX" amino acids 22 to 96 (75 residues), 30.9 bits, see alignment E=3.6e-11

Best Hits

KEGG orthology group: None (inferred from 68% identity to rec:RHECIAT_CH0000673)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RAH6 at UniProt or InterPro

Protein Sequence (136 amino acids)

>HGI48_RS04000 DoxX family protein (Dickeya dianthicola 67-19)
MSTTVLTAPAVLGRKTKVVSWILRILAAAAFLAAGGAKLAGVPMMVGIFDAIGIGQWFRV
VTGLVEVVGGIAILVPATAAFGGLLLAATMFFAVLTHIFVIGGNPVPAIVLLLVTATVAW
LHRASVVATLARWRQG