Protein Info for HGI48_RS03830 in Dickeya dianthicola 67-19

Annotation: HlyD family efflux transporter periplasmic adaptor subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details PF13533: Biotin_lipoyl_2" amino acids 53 to 100 (48 residues), 25 bits, see alignment 2.6e-09 PF00529: CusB_dom_1" amino acids 177 to 338 (162 residues), 47.4 bits, see alignment E=3e-16 PF16576: HlyD_D23" amino acids 207 to 285 (79 residues), 48.5 bits, see alignment E=1.4e-16 PF13437: HlyD_3" amino acids 209 to 319 (111 residues), 60.9 bits, see alignment E=3.7e-20

Best Hits

Swiss-Prot: 48% identical to EMRA_ECOLI: Multidrug export protein EmrA (emrA) from Escherichia coli (strain K12)

KEGG orthology group: K03543, multidrug resistance protein A (inferred from 51% identity to mmw:Mmwyl1_2004)

MetaCyc: 48% identical to multidrug efflux pump membrane fusion protein EmrA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-363; TRANS-RXN-364; TRANS-RXN-365

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RA59 at UniProt or InterPro

Protein Sequence (380 amino acids)

>HGI48_RS03830 HlyD family efflux transporter periplasmic adaptor subunit (Dickeya dianthicola 67-19)
MQDDKSTKKSGKKTALFIFPAAITICLSIYFLWTYVGNNTATTEDAYVEGNLVQVTSQVG
GTIIDIKADNTDYVKRGDVVVVINPIDTKVQLDKAKAQLASTVRAVRNQFANLQQLAAAI
EMKKTDYNKATADYRRRSGLSKSMAISVEDMNHASDAVNLAKAAVKVAESQYNAALVYTS
NTTPDSHPDVLTAEAVFRQAWLDWHRTNVIVPVSGVIAQRSIQVGQHISSGSTLMSIVPL
DSIWVTANFKETQLGNIKVGQNATLTSDVHGRGVQYKGKILGIEPGTGSAFSLLPAQNAT
GNWIKVVQRIPVRIELDKNLLSQYPLRPGLSMKVKVDTNSVGTGEIRPYNVTTQKWKTDV
YNNEDVTIDELIKQIVKENE