Protein Info for HGI48_RS03755 in Dickeya dianthicola 67-19

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 344 transmembrane" amino acids 24 to 44 (21 residues), see Phobius details amino acids 56 to 78 (23 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 114 to 136 (23 residues), see Phobius details amino acids 146 to 166 (21 residues), see Phobius details amino acids 186 to 207 (22 residues), see Phobius details amino acids 236 to 257 (22 residues), see Phobius details amino acids 264 to 285 (22 residues), see Phobius details amino acids 292 to 311 (20 residues), see Phobius details amino acids 317 to 337 (21 residues), see Phobius details PF02653: BPD_transp_2" amino acids 54 to 331 (278 residues), 146.7 bits, see alignment E=3.9e-47

Best Hits

KEGG orthology group: K10440, ribose transport system permease protein (inferred from 98% identity to dze:Dd1591_3336)

Predicted SEED Role

"Inositol transport system permease protein" in subsystem Inositol catabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RJ73 at UniProt or InterPro

Protein Sequence (344 amino acids)

>HGI48_RS03755 ABC transporter permease (Dickeya dianthicola 67-19)
MQQPLSRTKLPTPANGRGRIDPIAFFERFGVFIFMILLLIFFQLQNSNFLTERNITNILT
EVSIYGIMAVGMSFVILTAGIDLSVGSILAVCAMTAAYVIKGDNFTTVDAQAWGGMSWLV
GLGICLAMGTAIGFLHGLGVTRLRLSPFIVTLGGMTIWRGLTLVVNDGAPIAGFDPGYRW
WGRGELLGISIPIWIFALVALIGWLALHKTRWGRFVYAIGGNTEAARLAGVNVQRVLVSV
YVVIGALAGLAGFILSARLGSAEAVAGISFELRVIASVVIGGTSLMGGYGRISGTIIGSV
IMGILINGLVLMNVSAYYQQIITGLIIVLAVAFDTYAKSRRGAL