Protein Info for HGI48_RS03750 in Dickeya dianthicola 67-19

Annotation: sugar ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 515 PF00005: ABC_tran" amino acids 21 to 172 (152 residues), 112.2 bits, see alignment E=4.8e-36 amino acids 282 to 437 (156 residues), 78.3 bits, see alignment E=1.4e-25

Best Hits

Swiss-Prot: 45% identical to RGMG1_BURL3: Putative ribose/galactose/methyl galactoside import ATP-binding protein 1 (Bcep18194_B0624) from Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383)

KEGG orthology group: K10441, ribose transport system ATP-binding protein [EC: 3.6.3.17] (inferred from 98% identity to ddc:Dd586_0710)

Predicted SEED Role

"Inositol transport system ATP-binding protein" in subsystem Inositol catabolism

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.17

Use Curated BLAST to search for 3.6.3.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RA26 at UniProt or InterPro

Protein Sequence (515 amino acids)

>HGI48_RS03750 sugar ABC transporter ATP-binding protein (Dickeya dianthicola 67-19)
MTEPLLAITDLAKNFSGVWALNKVQLTVLPGEIHALLGENGAGKSTLLKALAGAQPQTSG
DIRFNGERLSPQDSPVERQNRGIVTIYQEFNLLPNMTVAENLFLGRELQRNRLFVDAQAV
NQEARTVLEYLQLNISPTTQVARLSVAQQQMVEIARALTLNARLIVMDEPSAALSDSEVA
SLHRVVRELKARGVSVIYVTHRLHEVFQLCDRFTVLQDGRYTGSGNVADIDVAGIIRMMV
GRDVVFTRRPPSETHHQDKPVRLAVKGLCRKKPPLDPHGIALDNIGFQVHEGEILGIAGL
VGAGRTEVARCLFGADPFTSGEFWLDGQPYHPVDPLHALEQGIALVPEDRKKEGAVLGLS
IRNNLSLSSLSSLLRWRYFVDTRREDDLIESYRQALRIKMVDSEQEVRKLSGGNQQKVIL
ARCMALNPRVLIVDEPTRGIDVGTKSEVHQVLFDMAKRGVAVIVISSDLPEVMAVSDRII
TLSEGRVTGELHGDDATEERLMTLMAICHDAQQAA