Protein Info for HGI48_RS03670 in Dickeya dianthicola 67-19

Annotation: L,D-transpeptidase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF03734: YkuD" amino acids 98 to 230 (133 residues), 79.9 bits, see alignment E=3.1e-26 PF17969: Ldt_C" amino acids 235 to 303 (69 residues), 84.4 bits, see alignment E=7.6e-28

Best Hits

Swiss-Prot: 66% identical to YBIS_ECO57: Probable L,D-transpeptidase YbiS (ybiS) from Escherichia coli O157:H7

KEGG orthology group: None (inferred from 96% identity to ddd:Dda3937_01175)

MetaCyc: 66% identical to L,D-transpeptidase LdtB (Escherichia coli K-12 substr. MG1655)
RXN0-5401

Predicted SEED Role

"L,D-transpeptidase YbiS"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9RA29 at UniProt or InterPro

Protein Sequence (365 amino acids)

>HGI48_RS03670 L,D-transpeptidase family protein (Dickeya dianthicola 67-19)
MSIRAILTLVVAAAAFSQTALAVVYPLPAPNSRLVGENIQVTIPSDSTDALEHFAAQYQM
GLSNLLEANPGIDVYLPKPGSTMTVPQQLILPDAPREGIVINSAEMRLYYYPKGSKTVVV
LPIGIGQLGKDTPINWVTSVQRKKERPTWTPTAAMHAEYAARGEFLPQVYPAGPDNPMGL
YALYIGNLYAIHGTNANFGIGLRVSHGCVRLRDKDIKYLFDHVPVGTRVQFINEPVKATV
EPDGSRYVEIHNPLSRTEEEFNSETPAPLKLTPVVTKVLADAGVSESAVNQALQSRMGMP
TKVNGAEENIAPIAPAVPAAPQAPAIQQTNAPATPDNAQPAAPQAQPTITDAAPAAAAAT
DASKS