Protein Info for HGI48_RS03340 in Dickeya dianthicola 67-19

Annotation: 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 PF08468: MTS_N" amino acids 8 to 162 (155 residues), 191.3 bits, see alignment E=2.9e-60 PF05175: MTS" amino acids 168 to 333 (166 residues), 193.5 bits, see alignment E=5.5e-61 PF06325: PrmA" amino acids 189 to 268 (80 residues), 25.7 bits, see alignment E=2e-09 PF13847: Methyltransf_31" amino acids 196 to 273 (78 residues), 30.2 bits, see alignment E=9e-11 PF13649: Methyltransf_25" amino acids 200 to 273 (74 residues), 32.6 bits, see alignment E=2.8e-11

Best Hits

Swiss-Prot: 75% identical to RSMC_PECAS: Ribosomal RNA small subunit methyltransferase C (rsmC) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 96% identity to ddd:Dda3937_02317)

MetaCyc: 72% identical to 16S rRNA m2G1207 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11576 [EC: 2.1.1.172]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase C (EC 2.1.1.52)" (EC 2.1.1.52)

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.172

Use Curated BLAST to search for 2.1.1.172 or 2.1.1.52

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9R9V7 at UniProt or InterPro

Protein Sequence (342 amino acids)

>HGI48_RS03340 16S rRNA (guanine(1207)-N(2))-methyltransferase RsmC (Dickeya dianthicola 67-19)
MSALTPASEVILRHSDEFVSRRVLFAGDLQDTLPANFDAAAVTVHTTQYHHWQQLQPVLG
DNVHFSLLAQAETVAGCDTLIYYWPKSKQEAQFQLFNLLSLLPVGCDIFVVGENRSGVRS
AEGILESIAAINKIDSARRCGLYHGRLETQPTFALEDWWLEYDVDGVPVHTLPGVFSREG
LDTGSQLLLSTLEPHRKGKVLDLACGAGVLAASFARLSPKIRLTLSDVGAAALEASRATL
AANGLEGQVIASNAYSDIQGRFDLIISNPPFHDGMQTSLHAAEVMIRGAASHLNLEGELR
IVANAFLPYPALLDDTFGSHEVIAQTGRFRVYRAVLRRNKNR