Protein Info for HGI48_RS03305 in Dickeya dianthicola 67-19
Annotation: GIY-YIG nuclease family protein
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 79% identical to Y453_YERE8: UPF0213 protein YE0453 (YE0453) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)
KEGG orthology group: K07461, putative endonuclease (inferred from 91% identity to dze:Dd1591_3453)Predicted SEED Role
"FIG137864: putative endonuclease containing a URI domain" in subsystem CBSS-214092.1.peg.3450
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A7L9R9T4 at UniProt or InterPro
Protein Sequence (100 amino acids)
>HGI48_RS03305 GIY-YIG nuclease family protein (Dickeya dianthicola 67-19) MKDTGSIWFLYLLRTGSGLLYTGITTDVARRLAQHQSGKGARALRGKGPLALVYHCVAGD RSTALKWEYRIKQLSKMQKERLVQHQPSTLIDFPPLIRSD