Protein Info for HGI48_RS03005 in Dickeya dianthicola 67-19

Annotation: phage holin family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 98 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 35 to 56 (22 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details PF04550: Phage_holin_3_2" amino acids 1 to 86 (86 residues), 142.4 bits, see alignment E=2.6e-46

Best Hits

Swiss-Prot: 70% identical to HOLIN_BPP2: Holin (Y) from Escherichia phage P2

KEGG orthology group: None (inferred from 80% identity to dda:Dd703_2110)

Predicted SEED Role

"Holin"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9R9P7 at UniProt or InterPro

Protein Sequence (98 amino acids)

>HGI48_RS03005 phage holin family protein (Dickeya dianthicola 67-19)
MNETDKSIVTLFIIGMLIAVGKVLAGGEPVTLRLFLGRVLLGGFVSTVAGVALVQFPDLS
PLAINGIGAALGIAGYQTIELLIQRRAKQLSDKADGNE