Protein Info for HGI48_RS02825 in Dickeya dianthicola 67-19

Annotation: 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 PF05175: MTS" amino acids 226 to 396 (171 residues), 171.8 bits, see alignment E=1e-54 PF06325: PrmA" amino acids 256 to 332 (77 residues), 25.4 bits, see alignment E=9.6e-10

Best Hits

KEGG orthology group: K00564, ribosomal RNA small subunit methyltransferase C [EC: 2.1.1.172] (inferred from 90% identity to ddd:Dda3937_03553)

Predicted SEED Role

"23S rRNA (guanine-N-2-) -methyltransferase rlmG (EC 2.1.1.-)" (EC 2.1.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.172

Use Curated BLAST to search for 2.1.1.- or 2.1.1.172

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9R9M9 at UniProt or InterPro

Protein Sequence (404 amino acids)

>HGI48_RS02825 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG (Dickeya dianthicola 67-19)
MSQLFLETHRLTLVRYPQSERESPLQAWEAADEYLLRELTSMPIGPGPRLIFNDAFGALA
CGLQAQAPCCISDSYLSQLATRHNLSLNGYAPESVTLHDSLAPLPDAPALVVLKVPKTLA
LLEHQLRQLREVVTPQTVIIAGAKARDIHTSTLQLFEQILGPTHTSLAWKKARLIHCRPE
PRVIDEQPRVIDEQPRVIDQQPRAIDQQPPMSVWTLDDADSPIHNYRIHNYANVFARSGP
DIGARFFIQHLPQQLDGKIVDLGCGNGIIGLTALAQNPQAYVSFFDESYMAVASSQRNVE
VNRPQDTARSSFVVNHALAGVGQDSLQAVLCNPPFHQQQAITDDIAWQMFLDARRCLAVG
GELRIVGNRHLDYFHKLKRLFGNCENVASNAKFGVLRAVKTHSR