Protein Info for HGI48_RS02425 in Dickeya dianthicola 67-19
Annotation: SDR family oxidoreductase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K14189, uncharacterized oxidoreductase [EC: 1.-.-.-] (inferred from 95% identity to ddd:Dda3937_02666)Predicted SEED Role
"FIG00613258: hypothetical protein"
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A7L9R9D3 at UniProt or InterPro
Protein Sequence (254 amino acids)
>HGI48_RS02425 SDR family oxidoreductase (Dickeya dianthicola 67-19) MKMTGNTILITGGGSGIGLALAAAFHQRGNQVIIAGRRETVLRQAAAAFPGMVWRALDQR DPAAINAFVGQLTQDYPALNVLINNAGIQRREDLTRPDPQLIDDTVSTNLLGPLWLTGAL IPHLLRQPHAAVLNVTSELAFLPQAITPTYCASKAALHAYTDALRCQLRQTSVQVIEIIP PWVQTGLQGDWGYDPRAMPLPDFIEETLALLSQQPAADEIVVERARALRFAEREGAYAER FRTFNVGLEMGSDG