Protein Info for HGI48_RS02425 in Dickeya dianthicola 67-19

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 254 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF08659: KR" amino acids 7 to 172 (166 residues), 30.2 bits, see alignment E=6.2e-11 PF00106: adh_short" amino acids 7 to 190 (184 residues), 143.7 bits, see alignment E=7.6e-46 PF13561: adh_short_C2" amino acids 15 to 188 (174 residues), 78.7 bits, see alignment E=7.8e-26

Best Hits

KEGG orthology group: K14189, uncharacterized oxidoreductase [EC: 1.-.-.-] (inferred from 95% identity to ddd:Dda3937_02666)

Predicted SEED Role

"FIG00613258: hypothetical protein"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9R9D3 at UniProt or InterPro

Protein Sequence (254 amino acids)

>HGI48_RS02425 SDR family oxidoreductase (Dickeya dianthicola 67-19)
MKMTGNTILITGGGSGIGLALAAAFHQRGNQVIIAGRRETVLRQAAAAFPGMVWRALDQR
DPAAINAFVGQLTQDYPALNVLINNAGIQRREDLTRPDPQLIDDTVSTNLLGPLWLTGAL
IPHLLRQPHAAVLNVTSELAFLPQAITPTYCASKAALHAYTDALRCQLRQTSVQVIEIIP
PWVQTGLQGDWGYDPRAMPLPDFIEETLALLSQQPAADEIVVERARALRFAEREGAYAER
FRTFNVGLEMGSDG