Protein Info for HGI48_RS02405 in Dickeya dianthicola 67-19

Annotation: molecular chaperone OsmY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 212 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF04972: BON" amino acids 64 to 131 (68 residues), 72.5 bits, see alignment E=1.4e-24 amino acids 144 to 211 (68 residues), 72 bits, see alignment E=2.1e-24

Best Hits

Swiss-Prot: 55% identical to OSMY_ECOLI: Osmotically-inducible protein Y (osmY) from Escherichia coli (strain K12)

KEGG orthology group: K04065, hyperosmotically inducible periplasmic protein (inferred from 90% identity to ddd:Dda3937_02671)

Predicted SEED Role

"Osmotically inducible protein OsmY"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9R9E0 at UniProt or InterPro

Protein Sequence (212 amino acids)

>HGI48_RS02405 molecular chaperone OsmY (Dickeya dianthicola 67-19)
MKKTKFVFSTKYAFLLGTVVLGTILTSGQALAEQETLAQQAQRIADTAGKKIDSSVQQAA
DYVDDSTLTARVKSALLKDETLDGNDISVSTHDGVVTLSGFIASQQMATGAVKIAGQTEG
VKSVSDKLQVKDNNGVQSVGMYADDTLTTGTIKAKLLADDIVPSRHVKVETRDGVVLLTG
QVTSRAQADRAEAIAKAVNGVKSVKNELTVKS