Protein Info for HGI48_RS02335 in Dickeya dianthicola 67-19

Annotation: DUF1440 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 180 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 139 to 157 (19 residues), see Phobius details PF07274: DUF1440" amino acids 22 to 155 (134 residues), 198.6 bits, see alignment E=2.3e-63

Best Hits

KEGG orthology group: K08996, putative membrane protein (inferred from 98% identity to ddd:Dda3937_03670)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9R9D6 at UniProt or InterPro

Protein Sequence (180 amino acids)

>HGI48_RS02335 DUF1440 domain-containing protein (Dickeya dianthicola 67-19)
MQARTVKEKIILAVMIGIIAGIICAIAKFGWEIPFPPRTPERDLTNPPQQLLQQLGMSFD
LSHLTYLFNGNPRPIMSFIMHFGFSITFTVLYCVAAEFWPRIKLWQGAFYGLVLWAVFHV
VLLPLFGTVPAPWDQPFAEHFSEIFGHMFCFWVAELARRDLRNRITHQSEDNTLTAQHAQ