Protein Info for HGI48_RS01635 in Dickeya dianthicola 67-19

Annotation: outer membrane channel protein TolC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 470 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR01844: type I secretion outer membrane protein, TolC family" amino acids 21 to 438 (418 residues), 440.6 bits, see alignment E=3e-136 PF02321: OEP" amino acids 25 to 209 (185 residues), 94.7 bits, see alignment E=3.3e-31 amino acids 234 to 424 (191 residues), 122.1 bits, see alignment E=1.3e-39

Best Hits

Swiss-Prot: 75% identical to TOLC_SALEN: Outer membrane protein TolC (tolC) from Salmonella enteritidis

KEGG orthology group: K12340, outer membrane channel protein TolC (inferred from 94% identity to ddd:Dda3937_00726)

MetaCyc: 75% identical to outer membrane channel TolC (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Type I secretion outer membrane protein, TolC precursor" in subsystem Multidrug Resistance Efflux Pumps or Ton and Tol transport systems

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9R8Z8 at UniProt or InterPro

Protein Sequence (470 amino acids)

>HGI48_RS01635 outer membrane channel protein TolC (Dickeya dianthicola 67-19)
MKKLLPLLISLGLGGFSAASQAEDLLQVYQQAKTTNPDLRSAAANRDAAFEKINEARSSL
LPQLGLGADYTYNNGYRDRKDVNNNVTSASLQLTQSIFNMSLWRALTLQEKQAGIQDVSY
QTSQQTLLLNTSTAYFNVLRAIDALSYVSAQKQSIYRQLDQTTQRFNVGLVAITDVQNAR
SQYDSVLASEVTARNNLDNAMETLRQVTGNFYPQLAGLNIDRFSPQKPDAVNGLLKEAEN
RNLSLLSARLSQDLAREQIRSAESGHLPTLNLTASTGVTNTNYSGSRVADSNLSDTYVGQ
NQIGLSFSLPIYSGGGTSSRVKQAQHSFVASSENMESAHRSVIQTLRSAHNNISASISSV
NAYKQAVISAQSSLDAMEAGYQVGTRTIVDVLDATTTLYNAKQQLSGARYDYLINQLNLK
QALGTLNEDDLRTLNAMLGKPVPTSAAIGDDAPAPVTTPVAVKTTAKARP