Protein Info for HGI48_RS01620 in Dickeya dianthicola 67-19

Annotation: 4,5-DOPA dioxygenase extradiol

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF02900: LigB" amino acids 12 to 261 (250 residues), 96.4 bits, see alignment E=8.7e-32

Best Hits

Swiss-Prot: 70% identical to YGID_ECOLI: 4,5-DOPA dioxygenase extradiol (ygiD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_00723)

MetaCyc: 70% identical to 4,5-DOPA dioxygenase extradiol (Escherichia coli K-12 substr. MG1655)
Stizolobate synthase. [EC: 1.13.11.29]

Predicted SEED Role

"Uncharacterized protein ygiD"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.13.11.29

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9R992 at UniProt or InterPro

Protein Sequence (262 amino acids)

>HGI48_RS01620 4,5-DOPA dioxygenase extradiol (Dickeya dianthicola 67-19)
MSTSRMPALFLGHGSPMNALDENDYTLAWRKLGETLPRPKAIVAVSAHWYTRGTAVTAMD
KPRTIHDFGGFPQALFDTQYPAPGAPDVAKRVQDLLAPVSVYADNQEWGLDHGTWGVLIK
VYPQADIPIVQLSIDGTKPPAYHYELGRKLAALRDEGIMIVASGNVVHNLRMIKWNGDGA
PYGWATEFNDFVRSNLAWQGDAAEHPLVNFMQHNDAALSNPTPDHFLPLLYVLGGWDGQE
PVSTPTDGIVMGSLSMMSVQVG