Protein Info for HGI48_RS01290 in Dickeya dianthicola 67-19

Annotation: DNA-binding transcriptional regulator Fis

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 98 PF02954: HTH_8" amino acids 55 to 95 (41 residues), 53 bits, see alignment E=1.2e-18

Best Hits

Swiss-Prot: 99% identical to FIS_PECCP: DNA-binding protein Fis (fis) from Pectobacterium carotovorum subsp. carotovorum (strain PC1)

KEGG orthology group: K03557, Fis family transcriptional regulator, factor for inversion stimulation protein (inferred from 99% identity to eoh:ECO103_4000)

Predicted SEED Role

"DNA-binding protein Fis" in subsystem DNA structural proteins, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CWA4 at UniProt or InterPro

Protein Sequence (98 amino acids)

>HGI48_RS01290 DNA-binding transcriptional regulator Fis (Dickeya dianthicola 67-19)
MFEQRVNSDVLTVSTVNSQAQVTQKPLRDSVKQALKNYFAQLNGQDVNDLYELVLAEVEQ
PLLDMVMQYTRGNQTRAALMMGINRGTLRKKLKKYGMN