Protein Info for HGI48_RS00740 in Dickeya dianthicola 67-19

Annotation: glycosyltransferase family 9 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details PF01075: Glyco_transf_9" amino acids 167 to 316 (150 residues), 81.2 bits, see alignment E=3.8e-27

Best Hits

KEGG orthology group: None (inferred from 94% identity to ddd:Dda3937_02035)

Predicted SEED Role

"Heptosyltransferase family protein, lipopolysaccharide core biosynthesis" in subsystem LOS core oligosaccharide biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9R8K2 at UniProt or InterPro

Protein Sequence (368 amino acids)

>HGI48_RS00740 glycosyltransferase family 9 protein (Dickeya dianthicola 67-19)
MSKFSARLRIFPRGLLQLLKKPWRRAPTAVKRILVAHNLLLGDTVMLTPLLAKLRGHYPQ
AAIVLLCKPAFVEVYRLNPYGVVPMPYQPASAASVSAIVNSGPYDLALIPGDNRYSWLAL
AAGSRWIVAHRPAQRNAKSWPVNEYRDYPVDAMAWGDAMAGLTDGELPAPQRWSAPACDF
SPPESPFVVLHVGASNPVRFWPPERWLALADWLAAQGYTPVWSGGGNERHIVDAIDPQRR
YRSFAGELSLSQLLTLLADAKALICADTGVAHLAKWVNTPTMTLYGPGNPVAFGPGRFWQ
NNPIINLGFHPIPCRDQHTLFGRELPWLERCNRNDTRCLQFCDGQSACMQQISLPEILTA
FTHLLRKI