Protein Info for HGI48_RS00665 in Dickeya dianthicola 67-19

Annotation: DUF202 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 112 transmembrane" amino acids 24 to 43 (20 residues), see Phobius details amino acids 49 to 69 (21 residues), see Phobius details amino acids 89 to 110 (22 residues), see Phobius details PF02656: DUF202" amino acids 13 to 78 (66 residues), 56 bits, see alignment E=2.3e-19

Best Hits

KEGG orthology group: None (inferred from 91% identity to ddd:Dda3937_03255)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9R8J8 at UniProt or InterPro

Protein Sequence (112 amino acids)

>HGI48_RS00665 DUF202 domain-containing protein (Dickeya dianthicola 67-19)
MTPSADTDTPPRDPGLQPERTQLAWSRTAVVLLVNSVLLLKAGSMKSQPLMLAVGLFLLL
MALITYIWSRLRLRALRRSGYPCTRQSMWMMRLLMLTVMATALSLLVNFISG