Protein Info for HGI48_RS00605 in Dickeya dianthicola 67-19

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 31 to 51 (21 residues), see Phobius details amino acids 279 to 306 (28 residues), see Phobius details amino acids 327 to 356 (30 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details PF12704: MacB_PCD" amino acids 32 to 249 (218 residues), 110.1 bits, see alignment E=1.8e-35 PF02687: FtsX" amino acids 286 to 399 (114 residues), 70.9 bits, see alignment E=9.5e-24

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 84% identity to dze:Dd1591_3982)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9R8G6 at UniProt or InterPro

Protein Sequence (406 amino acids)

>HGI48_RS00605 ABC transporter permease (Dickeya dianthicola 67-19)
MRERLSSGYGPSLRQRLTEPLESLRMLGRRAVLALLGIAVGCGAVVALINVGHNAEAQAM
AVFRNMGSDLLVANIQFPAVSQPPRYVPDTLDTAALREALPDILAASALIMTSVESRLQG
RRFNTMVVGVNPAFSQVLDLQIAQGRFLSQYDAHSTHAVLGARVVTELLAKGSPVTLGDR
VQLGGYLFQVVGILQARGQNPMMAVSVDDSILVPIEGMRRIVPSPQINSLLARNRRSETL
EQVAPQLQAVLQALLPGRQIDVQIPQQLLAGIAQQSRLFSWLLAGLGGISLLVGGVGVMN
VMLMNVAERRREIGVRMALGARPRDIASLFLLEAVALTAAGALVGAVGGIGAAWLFVTVS
GWAGFTLSPFSLCLGVGSSVLAGLFFGLTPALSAARLQPVQALRDE