Protein Info for HGI48_RS00515 in Dickeya dianthicola 67-19

Annotation: LuxR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 PF03472: Autoind_bind" amino acids 14 to 158 (145 residues), 129.2 bits, see alignment E=1.4e-41 PF00196: GerE" amino acids 179 to 233 (55 residues), 54.9 bits, see alignment E=8.2e-19

Best Hits

Swiss-Prot: 97% identical to EXPR_DICD3: Transcriptional activator protein ExpR (expR) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_03218)

Predicted SEED Role

"N-3-oxohexanoyl-L-homoserine lactone quorum-sensing transcriptional activator"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A7L9R8P8 at UniProt or InterPro

Protein Sequence (250 amino acids)

>HGI48_RS00515 LuxR family transcriptional regulator (Dickeya dianthicola 67-19)
MSISFSNVDFINSTIQNYLNRKLKAYGDPKYAYLIMNKKKPTDVVIISNYPPEWVDIYRN
NNYQHIDPVILTAINKIAPFSWDDDLVISSKLKFSRIFNLSKEYDIANGYTFVLHDPGNN
LAALSFMIEEHRSEELEEIIQNNKDKLQMLLISAHEKLTSLYREMSRNRNNSKSQEADLF
SQRENEILYWASMGKTYQEIALILGITTSTVKFHIGNVVKKLGVLNAKHAIRLGVEMNLI
KPVGPAKARS