Protein Info for HGI48_RS00425 in Dickeya dianthicola 67-19

Annotation: two-component system response regulator VfmH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 PF00072: Response_reg" amino acids 7 to 121 (115 residues), 80.6 bits, see alignment E=3.9e-26 PF00158: Sigma54_activat" amino acids 158 to 322 (165 residues), 218.6 bits, see alignment E=1.7e-68 PF14532: Sigma54_activ_2" amino acids 159 to 327 (169 residues), 71.3 bits, see alignment E=4e-23 PF01078: Mg_chelatase" amino acids 167 to 297 (131 residues), 29.5 bits, see alignment E=2e-10 PF00493: MCM" amino acids 175 to 299 (125 residues), 30.8 bits, see alignment E=6.6e-11 PF07728: AAA_5" amino acids 179 to 298 (120 residues), 31.2 bits, see alignment E=8.4e-11 PF00004: AAA" amino acids 180 to 298 (119 residues), 30.9 bits, see alignment E=1.4e-10 PF02954: HTH_8" amino acids 421 to 462 (42 residues), 35.3 bits, see alignment 3.2e-12

Best Hits

KEGG orthology group: None (inferred from 97% identity to ddd:Dda3937_00963)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A385XWC6 at UniProt or InterPro

Protein Sequence (467 amino acids)

>HGI48_RS00425 two-component system response regulator VfmH (Dickeya dianthicola 67-19)
MADKQHILIVDDDAHILASLQMLLSMEGYQVTLSSAVEQVPVQLSQHDFDLILMDMNYQR
DTTSGQEGLVLLEEIKRYDEYLPVVAMTGWGSVDIAVSAMQAGAVDFIQKPWDNERLLNV
IRQQISFSLSQRSGKRLKEENTLLKMELEDHFNGEWVVESAPMKQLMRVVEQIAATETNI
LILGENGTGKSLLARVIHQLSPRRDENMVSVNMGCINENLFESEMFGHVKGAFTDARESR
VGRFELADKGTLFLDEIGNLPMTQQSKLLRILEERCFERVGSSRTLKTHCRIIAATNAEL
DVRVAEGTFRQDLYYRFNTIELRVPSLVERQQDIMPLALNFIDRYARKYNKPAPGLSLSG
QAALSGYHWPGNIRELSHLLERAVLLCGSSRLNSDDIFPSLPTTAPQKVAKAEPELVSEA
TLADIEERLLCQRMAKFEGNAVKAARSLGLSRSAFYRRLEKYKINHE