Protein Info for HGI48_RS00360 in Dickeya dianthicola 67-19

Annotation: MarR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 166 PF13463: HTH_27" amino acids 52 to 121 (70 residues), 26.1 bits, see alignment E=1.2e-09 PF01047: MarR" amino acids 52 to 113 (62 residues), 52.6 bits, see alignment E=5.2e-18 PF12802: MarR_2" amino acids 52 to 112 (61 residues), 38.9 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 99% identical to PECS_DICD3: HTH-type transcriptional regulator PecS (pecS) from Dickeya dadantii (strain 3937)

KEGG orthology group: None (inferred from 99% identity to ddd:Dda3937_00976)

Predicted SEED Role

"Transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A3A4CYA8 at UniProt or InterPro

Protein Sequence (166 amino acids)

>HGI48_RS00360 MarR family transcriptional regulator (Dickeya dianthicola 67-19)
MARYLEVSDIVQQWRNERPDLDVEPMLVIGTLSRVSLLIDRALDKVFSKYKLSAREFDIL
ATLRRRGAPYAISPSQIVNALMINNSTLTSRLDRLEQAGWLRRMPIEGDRRSVNIQLTDE
GFALINRVVEEHVENERDILSPFSEEEKNQLRALLGRVEKHLVNNR