Protein Info for HER17_RS21790 in Pectobacterium carotovorum WPP14

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF05368: NmrA" amino acids 2 to 220 (219 residues), 84.6 bits, see alignment E=1.9e-27 PF01370: Epimerase" amino acids 2 to 103 (102 residues), 26.9 bits, see alignment E=8e-10 PF01073: 3Beta_HSD" amino acids 3 to 105 (103 residues), 30.7 bits, see alignment E=4.3e-11 PF07993: NAD_binding_4" amino acids 4 to 39 (36 residues), 22.2 bits, see alignment 1.8e-08 PF13460: NAD_binding_10" amino acids 6 to 184 (179 residues), 89.4 bits, see alignment E=6.8e-29

Best Hits

Swiss-Prot: 67% identical to QOR2_ECOLI: Quinone oxidoreductase 2 (qorB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to pct:PC1_4290)

MetaCyc: 67% identical to NAD(P)H:quinone oxidoreductase (Escherichia coli K-12 substr. MG1655)
1.6.5.-

Predicted SEED Role

"NADPH:quinone oxidoreductase 2"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (283 amino acids)

>HER17_RS21790 SDR family oxidoreductase (Pectobacterium carotovorum WPP14)
MIAITGASGQLGRLVIKQLLEKVPANDIVALVRDANKVADLSAKGVQVKAADYNQPEALA
SALQGVDKVLLISSSEVGQRAVQHRNVIDAAVKAGVKLVAYTSLLHADKSPLALAAEHQQ
TEVLLKASGLPHVLLRNGWYTENYAASIPAALEHGVFIGSAGEGKITSATREDFAAAAIA
VLTQEGQAGKVYELAGDEPYTLAELAAEVSKQSGKNIGYQNLSEAEFAAALVSAGLPDVF
AQIIADSDTGASKGGLFDDGKQLSRLIGRPTTPLSAVVKATLK