Protein Info for HER17_RS21585 in Pectobacterium carotovorum WPP14

Annotation: aspartate--ammonia ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 99% identical to ASNA_PECAS: Aspartate--ammonia ligase (asnA) from Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672)

KEGG orthology group: K01914, aspartate--ammonia ligase [EC: 6.3.1.1] (inferred from 98% identity to pwa:Pecwa_4535)

MetaCyc: 82% identical to asparagine synthetase A (Escherichia coli K-12 substr. MG1655)
Aspartate--ammonia ligase. [EC: 6.3.1.1]

Predicted SEED Role

"Aspartate--ammonia ligase (EC 6.3.1.1)" in subsystem Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 6.3.1.1)

MetaCyc Pathways

superpathway of L-aspartate and L-asparagine biosynthesis (4/4 steps found)
superpathway of L-asparagine biosynthesis (2/2 steps found)
L-asparagine biosynthesis II (1/1 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (330 amino acids)

>HER17_RS21585 aspartate--ammonia ligase (Pectobacterium carotovorum WPP14)
MKKQYIEKQQQISFVKSFFSSQLEQLLGLIEVQAPILSRIGDGTQDNLSGTEKAVQVKVK
ALPDATFEVVHSLAKWKRKTLGAYDFSFGEGIYTHMKALRPDEDRLSPIHSVYVDQWDWE
RVMGDGERNAEYLKSTVTRIYQGIKATEAAVHQAFGIQPFLPEQIHFVHTETLLQRYPDL
DAKGRERAIAKELGAVFLIGIGGKLSSGHSHDVRAPDYDDWTTPGEQELAGLNGDIVVWN
PVLNDAFEISSMGIRVDAETLTRQLALTQDEERLKLEWHQALLRGEMPQTIGGGIGQSRL
VMLLLQLPHIGQVQCGVWPQPLRESVSGLL